SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-153792190 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-153792190
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-153792190
Sequence length 331
Comment $ NYSGXRC $ SQ244492 $ PDBT196928 $
Sequence
MSKTFVKSKEMGELVNTPSWMDKGLGSQNEVKEEESRPGTYGMLSSLTEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEDKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLLHLKPQVFKSLGESSFGSH
LPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLEKSYSFMPHYPSSSLSSGHVHSTPFQA
GTPRYDVPIDMSYDSYPHHGIGTQLNTVFTE
Download sequence
Identical sequences Q9HD90
ENSP00000242994 ENSP00000242994 gi|153792190|ref|NP_067014.2| NP_067014.2.87134 NP_067014.2.92137 9606.ENSP00000242994 ENSP00000242994 NYSGRC-153792190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]