SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-16306588 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-16306588
Domain Number 1 Region: 328-604
Classification Level Classification E-value
Superfamily RNI-like 1.2e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.007
Further Details:      
 
Domain Number 2 Region: 265-335
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000785
Family F-box domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-16306588
Sequence length 621
Comment $ NYSGXRC $ SQ243676 $ PDBT198103 $
Sequence
MSPVFPMLTVLTMFYYICLRRRARTATRGEMMNTHRAIESNSQTSPLNAEVVQYAKEVVD
FSSHYGSENSMSYTMWNLAGVPNVFPSSGDFTQTAVFRTYGTWWDQCPSASLPFKRTPPN
FQSQDYVELTFEQQVYPTAVHVLETYHPGAVIRILACSANPYSPNPPAEVRWEILWSERP
TKVNASQARQFKPCIKQINFPTNLIRLEVNSSLLEYYTELDAVVLHGVKDKPVLSLKTSL
IDMNDIEDDAYAEKDGCGMDSLNKKFSSAVLGEGPNNGYFDKLPYELIQLILNHLTLPDL
CRLAQTCKLLSQHCCDPLQYIHLNLQPYWAKLDDTSLEFLQSRCTLVQWLNLSWTGNRGF
ISVAGFSRFLKVCGSELVRLELSCSHFLNETCLEVISEMCPNLQALNLSSCDKLPPQAFN
HIAKLCSLKRLVLYRTKVEQTALLSILNFCSELQHLSLGSCVMIEDYDVIASMIGAKCKK
LRTLDLWRCKNITENGIAELASGCPLLEELDLGWCPTLQSSTGCFTRLAHQLPNLQKLFL
TANRSVCDTDIDELACNCTRLQQLDILGTRMVSPASLRKLLESCKDLSLLDVSFCSQIDN
RAVLELNASFPKVFIKKSFTQ
Download sequence
Identical sequences Q9UKA2
ENSP00000229971 ENSP00000358247 ENSP00000229971 NYSGRC-16306588 ENSP00000229971 ENSP00000358247 NP_001265645.1.87134 NP_001265645.1.92137 NP_036292.2.87134 NP_036292.2.92137 XP_016866215.1.92137 9606.ENSP00000229971 gi|16306588|ref|NP_036292.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]