SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-19923477 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-19923477
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-21
Family Ubiquitin-related 0.00000723
Further Details:      
 
Domain Number 2 Region: 452-528
Classification Level Classification E-value
Superfamily UBA-like 4.26e-19
Family UBA domain 0.0001
Further Details:      
 
Domain Number 3 Region: 350-417
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000794
Family UBA domain 0.013
Further Details:      
 
Domain Number 4 Region: 236-389
Classification Level Classification E-value
Superfamily TPR-like 0.00000607
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-19923477
Sequence length 601
Comment $ NYSGXRC $ SQ79134 $ PDBT196435 $
Sequence
MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVI
EEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETF
GLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAK
LKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYH
EKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECL
DDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAY
EYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQ
IRKEEKEKKRRRLENIRFLKGMGYSTHAAQQILLSNPQMWWLNDSNPETDNRQESPSQEN
IDRLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSD
SAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKK
N
Download sequence
Identical sequences A0A090N8Q5
XP_016867795.1.92137 9606.ENSP00000398644 NYSGRC-19923477 gi|19923477|ref|NP_057202.2| ENSP00000457628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]