SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-32698790 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-32698790
Domain Number 1 Region: 52-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000017
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-32698790
Sequence length 330
Comment $ NYSGXRC $ SQ244592 $ PDBT197994 $
Sequence
MGKIDVDKILFFNQEIRLWQLIMATPEENSNPHDRATPQLPAQLQELEHRVARRRLSQAR
HRATLAALFNNLRKTVYSQSDLIASKWQVLNKAKSHIPELEQTLDNLLKLKASFNLEDGH
ASSLEEVKKEYASMYSGNDSFPQNGSSPWYLNFYKQTMDLLTGSGIITPQEAALPIVSAA
ISHLWQNLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVS
TPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCA
NTQVKQEASFPVDEEMIMLQCTETFDDEDL
Download sequence
Identical sequences Q7Z7C7
ENSP00000275764 NP_872295.1.87134 NP_872295.1.92137 NYSGRC-32698790 ENSP00000275764 gi|32698790|ref|NP_872295.1| ENSP00000275764 9606.ENSP00000275764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]