SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-5730037 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NYSGRC-5730037
Domain Number - Region: 496-621
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family IMD domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-5730037
Sequence length 708
Comment $ NYSGXRC $ SQ244381 $ PDBT196644 $
Sequence
MATTAELFEEPFVADEYIERLVWRTPGGGSRGGPEAFDPKRLLEEFVNHIQELQIMDERI
QRKVEKLEQQCQKEAKEFAKKVQELQKSNQVAFQHFQELDEHISYVATKVCHLGDQLEGV
NTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKIKEAADIIQKLHLIAQELPFDRFSE
VKSKIASKYHDLECQLIQEFTSAQRRGEISRMREVAAVLLHFKGYSHCVDVYIKQCQEGA
YLRNDIFEDAGILCQRVNKQVGDIFSNPETVLAKLIQNVFEIKLQSFVKEQLEECRKSDA
EQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTFLSKLIKSIFISYLENYIEVETGYLKSR
SAMILQRYYDSKNHQKRSIGTGGIQDLKERIRQRTNLPLGPSIDTHGETFLSQEVVVNLL
QETKQAFERCHRLSDPSDLPRNAFRIFTILVEFLCIEHIDYALETGLAGIPSSDSRNANL
YFLDVVQQANTIFHLFDKQFNDHLMPLISSSPKLSECLQKKKEIIEQMEMKLDTGIDRTL
NCMIGQMKHILAAEQKKTDFKPEDENNVLIQYTNACVKVCAYVRKQVEKIKNSMDGKNVD
TVLMELGVRFHRLIYEHLQQYSYSCMGGMLAICDVAEYRKCAKDFKIPMVLHLFDTLHAL
CNLLVVAPDNLKQVCSGEQLANLDKNILHSFVQLRADYRSARLARHFS
Download sequence
Identical sequences H2R434 O00471
NP_006535.1.87134 NP_006535.1.92137 XP_003831717.1.60992 XP_509969.2.37143 9606.ENSP00000389934 NYSGRC-5730037 ENSP00000342100 ENSP00000389934 ENSPTRP00000046511 gi|5730037|ref|NP_006535.1| ENSP00000484855 ENSPTRP00000046511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]