SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-IgSF-Q99M80 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-IgSF-Q99M80
Domain Number 1 Region: 866-1194
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.03e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000135
Further Details:      
 
Domain Number 2 Region: 1159-1454
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000168
Further Details:      
 
Domain Number 3 Region: 34-193
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-37
Family MAM domain 0.000000552
Further Details:      
 
Domain Number 4 Region: 394-588
Classification Level Classification E-value
Superfamily Fibronectin type III 1.36e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 291-428
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000273
Family Fibronectin type III 0.0062
Further Details:      
 
Domain Number 6 Region: 196-299
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000116
Family I set domains 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-IgSF-Q99M80
Sequence length 1455
Comment $ NYSGXRC $ SQ252070 $ PDBT188523 $
Sequence
MGSLGGLALCLLRLLLLGLQRPPLPGAGAQSAAGGCSFDEHYSNCGYSVALGTNGFTWEQ
INTWEKPMLDPAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCIDFHYYFSSRDRSS
PGALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGY
IAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQQWNGRDTA
LMVTRVVNHRRFSATVSVADTSQRSISKYRCVIRSDGGSGVSNYAELIVKEPPTPIAPPE
LLAVGATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIVDSPNYKLWHLDPDVEY
EIRVLLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIRARQLTLQWEPFGYAVTR
CHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTIRLRLLLSNPEGRMESEEL
VVQTEEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVITLYEINYKAVGSLDPSADLS
SQRGKVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGPPVTTRIATKISAPSMPEYDA
DTPLNETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQKSRRAADIIECFSVPVSYRNAS
NLDSLHYFAAELKPSNLPVTQPFTVGDNKTYNGYWNPPLSPLKSYSIYFQALSKANGETK
INCVRLATKGASTQNSNTVEPEKQVDNTVKMAGVIAGLLMFIIILLGVMLTIKRRKLAKK
QKETQSGAQREMGPVASTDKPTAKLGTNRNDEGFSSSSQDVNGFTDGSRGELSQPTLTIQ
THPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQMKRGQGYGFKEEYEALPEGQTASWDT
AKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHSDYINANYIDGYHRPRHYIATQGPMQE
TVKDFWRMIWQENSASIVMVTNLVEVGRHPAEHTVGTATLGRAASPGMVKCVRYWPDDTE
VYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCYATGLLGFV
RQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVRELRAQRVNL
VQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIKDEFQTLNIVT
PRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAALMDSHKQPAAF
VVTQHPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQLCMQYWPEKTSGCYGPIQVEFVSA
DIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSLLKVVRRLEKWQEQ
YDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKTLRNNKSNMVETLEQ
YKFVYEVALEYLSSF
Download sequence
Identical sequences ENSMUSP00000105071 ENSMUSP00000105067 NP_001278078.1.92730 10090.ENSMUSP00000105067 ENSMUSP00000105067 NYSGRC-IgSF-Q99M80

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]