SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGRC-LECT-ENSP00000296130 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGRC-LECT-ENSP00000296130
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-33
Family C-type lectin domain 0.000000196
Further Details:      
 
Domain Number 2 Region: 47-74
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000785
Family Triple coiled coil domain of C-type lectins 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGRC-LECT-ENSP00000296130
Sequence length 202
Comment $ NYSGXRC $ SQ251736 $ PDBT188727 $
Sequence
MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVAL
LKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEY
LRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAA
NGKWFDKRCRDQLPYICQFGIV
Download sequence
Identical sequences A0A024R2Q7 G1R285 H2QMF6 P05452
ENSNLEP00000007307 ENSNLEP00000007307 ENSP00000296130 NYSGRC-LECT-ENSP00000296130 ENSPTRP00000025572 gi|156627579|ref|NP_003269.2| NP_003269.2.87134 NP_003269.2.92137 XP_003257014.1.23891 XP_003309814.1.37143 XP_003818539.1.60992 9606.ENSP00000296130 ENSP00000296130 ENSPTRP00000025572 ENSP00000296130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]