SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-6236a from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-6236a
Domain Number 1 Region: 5-326
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.29e-114
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000000359
Further Details:      
 
Domain Number 2 Region: 325-489
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-39
Family Glycosyl hydrolases family 32 C-terminal domain 0.00033
Further Details:      
 
Weak hits

Sequence:  NYSGXRC-6236a
Domain Number - Region: 521-624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00882
Family Galectin (animal S-lectin) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-6236a
Sequence length 653
Comment $ NYSGXRC $ SQ164893 $ PDBT172246 $
Sequence
ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSK
DLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIA
YSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQ
WTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGD
FDGTHFKNENPPNKVLWTDYGRDFYAAVSWSDIPSTDSRRLWLGWMSNWQYANDVPTSPW
RSATSIPRELKLKAFTEGVRVVQTPVKELETIRGTSKKWKNLTISPASHNVLAGQSGDAY
EINAEFKVSPGSAAEFGFKVRTGENQFTKVGYDRRNAKLFVDRSESGNDTFNPAFNTGKE
TAPLKPVNGKVKLRIFVDRSSVEVFGNDGKQVITDIILPDRSSKGLELYAANGGVKVKSL
TIHPLKKVWGTTPFMSNMTGWTTVNGTWADTIEGKQGRSDGDSFILSSASGSDFTYESDI
TIKDGNGRGAGALMFRSDKDAKNGYLANVDAKHDLVKFFKFENGAASVIAEYKTPIDVNK
KYHLKTEAEGDRFKIYLDDRLVIDAHDSVFSEGQFGLNVWDATAVFQNVTKES
Download sequence
Identical sequences 418943 NYSGXRC-6236a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]