SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NYSGXRC-8650b from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NYSGXRC-8650b
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.7e-58
Family Dual specificity phosphatase-like 0.00000152
Further Details:      
 
Domain Number 2 Region: 125-331
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.23e-45
Family Dual specificity phosphatase-like 0.000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NYSGXRC-8650b
Sequence length 603
Comment $ NYSGXRC $ SQ106515 $ PDBT180246 $
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIISTLD
DMSIGANLSKLQSTERIGENNFEDEDMEIKNNVTQGDKLRALKSQRHPRSSPSCAFRSDD
MKGHQRAMAQTFRLSSSPQPTMSTMKTSKVCLSPSVTAKKISRGSLSSGANIRSFSINSR
LASSLGNLNAGTEEPETKKTTSLTKAAFIASPFTSFLNGSTQTPGRNYPELNNNQYTRSS
NSNSSSSSSGLGGNLNSSPVPQSAKPEEHTTILRPSFPGSLSSSSVRFLSRSIPSLQSEY
VHY
Download sequence
Identical sequences Q6GQT0
ENSMUSP00000087950 ENSMUSP00000087950 10090.ENSMUSP00000087950 ENSMUSP00000087950 NYSGXRC-8650b NP_001074287.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]