SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NsR198 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NsR198
Domain Number - Region: 50-73
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00153
Family Intron-encoded homing endonucleases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NsR198
Sequence length 102
Comment $ NESG $ SQ109610 $ PDBT139836 $
Sequence
MIQGKYPDNWKQLATALKAASNWRCSKCGRVCLRPGEKPDNLTFSERKAHTLQVHHWNRD
PSDNRLENLVCLCSGCHLSYHRFGRGNVSPGQLSLFAEQKVS
Download sequence
Identical sequences A0A1Z4KUJ5 Q8YL21
WP_010999674.1.33676 gi|17233133|ref|NP_490223.1|NC_003276 103690.all7117 gi|17233133|ref|NP_490223.1| NsR198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]