SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NsR99 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NsR99
Domain Number 1 Region: 3-324
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.25e-45
Family Pectate transeliminase 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NsR99
Sequence length 602
Comment $ NESG $ SQ92486 $ PDBT132014 $
Sequence
MTQTFYVNPSTGNDANPGSQTAPFKTITQALKVASPDTTIQLANGNYNAASGEVFPLTIP
SSVKVVGNETSKGSNILIEGSGNYLSRTFAGQNVTFVLLNNAELRGVTVTNPASRGSGAW
IESTTPTVANSTFINCKREGVFATGDANPVITGNVFTENAANGMAIAKNSKGQIQGNICF
KTGFGIAVSDTTSPTLIDNKIYENRSGIVVSGTARPILRNNLVENNTDDGLTVIGNALPD
IGNTSNPGGNTLRNNAKFDLQNASSHKLISIGNQLDTTKVTGNVEFIVSQIPTPTPIPTP
TPTPIPTPTPTPIPTPTPTPIPTPTPTPTPTPTPTPTPTPTPTPIPTPTPTPTPIPTPIP
TPIPIPTPIPTPTPIPTPIPTPIPTPTPIPTPIPTPIPTPTPIPTPNPINLKDIGNHWAA
PFIRELVRQGIVSGFPDGTFKPDATMTRAQYAALLVKAFNPSPNRAVIRFKDLAENFWAF
KVIQQAYQGLFLAGFPDNTFRPNDNIQRVQVVVSLVNGLGLGLSANVTNTIKAFDDQAKI
PDYAKDEVAKAIEKGIIVNYPNIKQLNPTRDATRAEVVAIVYQALVDGDRVAAINSPYIV
NA
Download sequence
Identical sequences A0A1Z4KFI0 Q8YV91
WP_010996248.1.33676 NsR99 gi|17229582|ref|NP_486130.1| 103690.alr2090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]