SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for RdR84 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  RdR84
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.63e-49
Family Ribonuclease PH domain 1-like 0.0000254
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-46
Family Ribonuclease PH domain 1-like 0.0000151
Further Details:      
 
Domain Number 3 Region: 453-545
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.66e-26
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 145-242
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.17e-26
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 611-696
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-22
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 6 Region: 550-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.87e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 7 Region: 245-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000141
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) RdR84
Sequence length 711
Comment $ NESG $ SQ208147 $ PDBT164031 $
Sequence
MFNETKKSIEWGEETLTLETGKVARQADGSVIATLGETSVMANVTFAKKQKPGQDFFPLT
VHYQEKYYAAGKVPGGFFKREARPTEKETLTARLIDRPLRPLFVPGFKNEVLVMCTVLSH
DLVNDPDMVAMIAASAALTISGAPFMGPIAGARVGFEDGEYILNPTVDDMQDLRLNPEQR
LDLVVAGTKDAVMMVESEAYELSEAEMLGAVKFAHDAIQPVLDLIIDLAEDCAKEPFDFS
PPDYSELSAAVKAAGETEMRAAFAISDKQERTTAVAAARETIMAALSDEQKEDPNLGSAM
KGLEASILRGDVVKTGKRIDGRKTDEIRDIVCETGLLPRTHGSALFTRGETQGLVVTTLG
TGDDEQFIDALHGNFKSNFLLHYNFPPYSVGEAGRVGPPGRREIGHGKLAWRALQAVLPA
ATDFPYTVRVVSEITESNGSSSMASVCGGSLSMMDAGVPLKAPVAGVAMGLILEEDGSYA
ILSDILGDEDHLGDMDFKVAGTEAGITSLQMDIKIAGITPEIMEKALEQAKAGRIHILGE
MAKSITGAQDFSIHAPRIETMQIPTDKIREVIGSGGKVIREIVEVSGAKVDINDEGIIKI
ASPNGEAIKKAYDMIHSIVAEPEEGMVYTGTVVKIVDFGAFVNFFGKRDGLVHVSQIENR
RLNHPSDVLKEGQEVKVKLLGFDDRGKVRLSMKVVDQETGEEIKKEEAPAD
Download sequence
Identical sequences Q16CF6
375451.RD1_0637 RdR84 WP_011566959.1.1045 WP_011566959.1.29122 gi|110678016|ref|YP_681023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]