SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T01G6.5 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T01G6.5
Domain Number 1 Region: 149-378
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.18e-30
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-23
Family Nuclear receptor 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) T01G6.5
Sequence length 383
Comment $ SECSG $ SQ42153 $ PDBT12244 $
Sequence
MSKKCGICDAPAHGRHFGALTCLSCAAFFRRAIFAKKKRKSCKSGNKCRDFNGNFPQCKS
CRMRKCLRVGMKLESKSPPPAAIPQSLEVFVSRPSMILFANKPSQTRNFIDVSNLVARGL
SILKHGAQSPLNQKLTSLEKMALAGSPSMKKFMKVNEVTSKYVAKVWEFDFITAARCLAN
LDGFSELPDKLKMQILQSIWHVWARLFKAARSAQLRKRQGLFSNALQISDNLYVEMETIR
MDVTWLTRYSFDQVKYFLYGVEEDSYLKDSIESLTKLELTEIELIYMTAQLSFLYAQNRF
SGTEIGEICEKLQDGLGNDLHNYYTKPEKKNRNYVGRLTQMLKINFSLMKNIRTTRERSL
IAQTFDIFIADYSHPEMFIDTGC
Download sequence
Identical sequences O16965
NP_503218.1.50509 6239.T01G6.5 T01G6.5 T01G6.5 T01G6.5 T01G6.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]