SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T27F7.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T27F7.2
Domain Number 1 Region: 542-668
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-19
Family SH2 domain 0.0018
Further Details:      
 
Domain Number 2 Region: 139-253
Classification Level Classification E-value
Superfamily PH domain-like 3.96e-16
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) T27F7.2
Sequence length 732
Comment $ SECSG $ SQ52300 $ PDBT8189 $
Sequence
MPVLSKLARKMYSRLKSSLLNHFQKGANSSSNPSYNGLTKEEKKRLRHSLAECQLNDVYD
PDSAHSSYQHSVSFVTTKPSSRHHQQTIDTSGHAPLAPQEVYLDETSSNSASTFYSDLLA
SSFSSAGGNSSFTCDYEDTNETSFIMSSGLPALSWNVQYIGSFPISGSYVDNLGRRIDSF
QPTTSGGMQSVELSISVLGVKICCEKTVLMSHSLRRVTDISARPDTQNIGYVATEPVGRT
YRRLCHVFHCQSLKEVSLKIHSVNVKLPGKSENRKSSTGVWALFAPIADHHIVTPVALFR
LNLYNFKIGKNLQNNFEMWAIKIFKMFMGRNIFDQQDPEITIFKVSNSPAEEIENVLRNA
NQSQVLAAKQPKSAVSTSSMHPTNTASTMTEKRSASTVFLNRFLGKKGSQTVDESGQCKR
KRRPVSAVFSSAIHRLSSSTSSVNPKRMSTIEPQAPTREQLLQLQNQMRCAASSPVPEEP
RPTDLCAASTTTSTSSVASSSSSNGSSSSTDTSPVPPAPQTALVYDEKLGEWIYPIDQAL
MTQLDNCSYFVGQPTKDSMVYNLNTQPEGAFVIRYSESKSKCLALSMRVPCSHNPSGISH
YLIIRNEQGFRLKLSATKKPFPTLQMMLTHHSVLESHLPCTLHFVQWQKTNFKQLAAMST
VERPLRTFNRHSTALTKIDENRNVTATSTPYRPSGRCGGGIDDFTTPKNRRTRNEINAMR
RSHFFDDRQIVL
Download sequence
Identical sequences 6239.T27F7.2a T27F7.2 T27F7.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]