SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tcru016704AAA from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tcru016704AAA
Domain Number 1 Region: 6-215,244-271
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 2.22e-64
Family Tubulin, GTPase domain 0.00000644
Further Details:      
 
Domain Number 2 Region: 272-460
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 3.97e-42
Family Tubulin, C-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Tcru016704AAA
Sequence length 479
Comment $ SGPP $ SQ72957 $ PDBT230919 $
Sequence
GPGSMPREIVSIQVGQCGNQLGLKWWDVMMQEQKANPQYPDARDALFISEPVGKDGSVTL
KARCVAIDMEEGVLRSMLRGPLQGLFDATFFVSDVSGAGNNWAVGHMEYGDKYIDSISDS
VRGQVECCDSIQSFFVMHSLSGGTGSGLGTRVLGMLEEEFPHIFRICPVVMPGAVDDVVT
APYNTAFAVRELIEHADAVVPLDNDALSRMADSALGRKSMHNADGEILRGGVPDVHTYSV
AEPTKTKLPYDSMNAVVAQLLSNLTCAMRFPGPLNMDINEITTNLVPYPRLLFLTAAIAP
LNVARYSVAAGPRSIDTLLASCLEKDHQYVDVSGGTKSALTKDAGTCLATALIARGPQIT
VGDLARNIPRIRERQKLVYWNEDGFKTALCSVSPLGHRDSVLMLANHTSIAQKLETIYER
FTRLYNVRSHVHHYERFLELSYFDASAEILSTTVDDYNFLNTEEPPTDVPQSMRELVYY
Download sequence
Identical sequences Tcru016704AAA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]