SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y67A6A.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y67A6A.2
Domain Number 1 Region: 264-505
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-34
Family Nuclear receptor ligand-binding domain 0.00079
Further Details:      
 
Domain Number 2 Region: 95-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-28
Family Nuclear receptor 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Y67A6A.2
Sequence length 515
Comment $ SECSG $ SQ46588 $ PDBT8315 $
Sequence
MFSTLSPSAIDDILRHAVHFGQGTTAIAPSPVTFISTTTQQSLGATYPGVFNPTTPTFNH
YQHQALPVTMHTSTSSAHHTTTGHGRGRRKNSTINLVCVVCGDQAFGKHYGVNACNGCKG
FFRRSVWHNRQYLCRFEGRCAIAKEHRNVCRACRLKQCFVAGMNPRAVQSERVEREQNGS
PNQIEEDDYKDLSSPDTCSVEIQTDVDEQKPSSNNSAPLPSMELEMAKLSEQIVEMHRAV
CSYVDPVTKRENFDMKMETETTKIAFMNAFYNPEMIGPRTPLDITGRRVATVKDVMDEWK
RNFVLFSDWLRALPEYNQMSIEDQIVLAKNRYGTFHWWMCANWTVQAGCEGVCYSNGAYF
PKQPEAQCIPDVKGSSGRMYDSLSIPIKELNLDETEIVLMLAVIIFSDEITELADLTPAG
KEHVRMVGNRFVRMLHHHVNSKEYGEAMENGDDTQNSSESQAAVRIAKMMILLSATTNLV
YLTSDNIQLMEVLHVVPSEYLCHEVQFIQNSYETP
Download sequence
Identical sequences O02279
Y67A6A.2a Y67A6A.2a 6239.Y67A6A.2a NP_492607.1.50509 Y67A6A.2 Y67A6A.2a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]