SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YTYst418 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YTYst418
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily TPR-like 0.0417
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YTYst418
Sequence length 129
Comment $ NESG $ SQ29505 $ PDBT116964 $
Sequence
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY
Download sequence
Identical sequences P38215
YTYst418 YBR013C 4932.YBR013C NP_009569.1.97178 YBR013C YBR013C YBR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]