SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK632.6 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK632.6
Domain Number 1 Region: 262-401
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.05e-53
Family P-domain of calnexin/calreticulin 0.00000294
Further Details:      
 
Domain Number 2 Region: 73-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-52
Family Calnexin/calreticulin 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ZK632.6
Sequence length 619
Comment $ SECSG $ SQ53576 $ PDBT4863 $
Sequence
MVNRKWMYIFIQFLLVSSIRSDDDVFEDDEEEVTKGSDDKEEFVPSLFVAPKLSDKSTPN
FFDYFPVGSKIGLTWIKSLAKKDDVDSDIAKYNGEWSIGAPTKVSIEGDLGLIVKTKARH
HAIAAKLNTPFAFDANTFVVQYDIKFEEGQECGGGYLKLLSEGAEKDLANFQDKTAYTIM
FGPDKCGATGKVHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEY
SVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENE
PQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGT
WKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWT
MSENILFDNILITSSEEDSSDVAKQTFYVKQKEEYRLAAATGNGNGFFQQIIDATNEKPW
LWAVYILCVLLPLVAIGVFCFGKQSKPTPNFAKKSDAYSADDDRVPNLVDDDEEEIIGDE
EDDVNQPGPSGSQSNPEPQDEEENAEQQSANSSQSSAAEEEDDEHVVPENEPVKPTEEFA
KKSPKNTGGAKRRTARRGD
Download sequence
Identical sequences P34652
6239.ZK632.6 NP_499176.1.50509 CE00423___KOG0675 ZK632.6 ZK632.6 ZK632.6 ZK632.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]