SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mmt007018941.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt007018941.1
Domain Number 1 Region: 52-271
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.49e-72
Family Calnexin/calreticulin 0.0000000422
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.15e-58
Family P-domain of calnexin/calreticulin 0.00000033
Further Details:      
 
Weak hits

Sequence:  mmt007018941.1
Domain Number - Region: 401-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000253
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mmt007018941.1
Sequence length 578
Comment $ RSGI $ SQ85923 $ PDBT235336 $
Sequence
MRFQGVGLCLGLLFITVNADFMDDGVEVEDFSENSDESNIKDEPSSGTFKYKTPQPIGEV
YFTETFDSGNLAGWVLSKAKKDDMDSEIAIYDGRWEIEELKENQVPGDRGLVLKSKAKHH
AIAAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLILENFYDKTSYTIMF
GPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFE
VLIDQKVVNQGTLLDDVVPPINPPREIDDPSDKKPEEWDDRAKIPDPTAVRPEDWDENEP
AQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQIGCGEWKP
PMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTP
DIYFDNFIICSEKEVADQWATDGWELKIMVANANEPGVLRQLVIAAEERPWLWLMYLVMA
GLPVALVASFCWPRKVKKKYEDTGPKKTELCKLQSKAALEQEAEEEKAPEKPEDVQEEKK
PGEAEVVTVEKEVIGEPEEKSKEDRETLEGQEEVSKAE
Download sequence
Identical sequences mmt007018941.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]