SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for mmt008010878.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  mmt008010878.1
Domain Number 1 Region: 9-256
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-63
Family Caspase catalytic domain 0.0000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) mmt008010878.1
Sequence length 257
Comment $ RSGI $ SQ135487 $ PDBT235516 $
Sequence
MESEMSDPQPLQEERYDMSGARLALTLCVTKAREGSEVDMEALERMFRYLKFESTMKRDP
TAQQFLEELDEFQQTIDNWEEPVSCAFVVLMAHGEEGLLKGEDEKMVRLEDLFEVLNNKN
CKALRGKPKVYIIQACRGEHRDPGEELRGNEELGGDEELGGDEVAVLKNNPQSIPTYTDT
LHIYSTVEGYLSYRHDEKGSGFIQTLTDVFIHKKGSILELTEEITRLMANTEVMQEGKPR
KVNPEVQSTLRKKLYLQ
Download sequence
Identical sequences O89094 Q542Q1
ENSMUSP00000005488 ENSMUSP00000005488 10090.ENSMUSP00000005488 ENSMUSP00000005488 mmt008010878.1 NP_033939.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]