SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for pho001000147.5 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  pho001000147.5
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.51e-52
Family Biotin holoenzyme synthetase 0.0000000239
Further Details:      
 
Domain Number 2 Region: 190-233
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000000000849
Family Biotin repressor (BirA) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) pho001000147.5
Sequence length 235
Comment $ RSGI $ SQ81688 $ PDBT235714 $
Sequence
MLGLKTSIIGRRVIYFQEITSTNEFAKTSYLEEGTVIVADKQTMGHGRLNRKWESPEGGL
WLSIVLSPKVPQKDLPKIVFLGAVGVVETLKEFSIDGRIKWPNDVLVNYKKIAGVLVEGK
GDKIVLGIGLNVNNKVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNPMDILN
LVRDNMILGVRVKILGDGSFEGIAEDIDDFGRLIIRLDSGEVKKVIYGDVSLRFL
Download sequence
Identical sequences O57883
2dtoA WP_010884259.1.38245 1wnl_A 1wnl_B 1wpy_A 1wpy_B 1wq7_A 1wq7_B 1wqw_A 1wqw_B 1x01_A 1x01_B 2dkg_A 2dkg_B 2dth_A 2dth_B 2dti_A 2dti_B 2dto_A 2dto_B 2fyk_A 2fyk_B pho001000147.1 pho001000147.10 pho001000147.11 pho001000147.12 pho001000147.2 pho001000147.5 pho001000147.6 pho001000147.7 pho001000147.8 pho001000147.9 gi|14590088|ref|NP_142152.1| 70601.PH0147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]