SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCBG_01736T0 from Histoplasma capsulatum G186AR

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCBG_01736T0
Domain Number 1 Region: 654-850
Classification Level Classification E-value
Superfamily Sec7 domain 2.22e-61
Family Sec7 domain 0.0000231
Further Details:      
 
Domain Number 2 Region: 393-505,558-589,988-1122,1178-1304,1343-1488
Classification Level Classification E-value
Superfamily ARM repeat 0.000000023
Family PBS lyase HEAT-like repeat 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HCBG_01736T0
Sequence length 1623
Comment | HCBG_01736 | Histoplasma capsulatum G186AR Sec7 domain-containing protein (1624 aa)
Sequence
MTIALERLNGHDSPGILDPSTSGSVTQNAPTDLPDLYQSGNMKGRNTIPIAVNPVELVTT
ECITVTSSMRKHSRWAHSSVAAILSGGGASRSYERELSVPLNVSLATKSQSTIAPTKSGS
AGVEGEHALASRWGLRGKKGKSLQDNPLMSAFTRLRIDLKDCKDIRDFDTPALLHPFLQV
IRSSSTSAPITSLALISITKFFSYNIINRDSPRLSMALQLLSAAVTHCRFEATDSAADEI
VLLRILKLMEGMLSRAEGELLGDESVCEMMETGLSMCCQVRLSEVLRRSAEMSMINMCQV
IFQRLSQLDVEDLPVPNLPQEEHSQMEAGNFKMDPSVDGDTVTSQHHSSLGMDTSTPTKD
RSSGEDDSEATFNGDTTTNQPAPHENMSPEVKPYSLPSIRELFRVLIDLLDPHNRQHTDT
MRVMSLRIIDVALEVAGPSIARHPSLAQLAKDDLCRHLFQLVRSENMALLNGSLRVAGTL
LSTCRNVLKLQQELFLSYLVACLHPRVEIPREPGIDPNLYSGVPQAPKLVKPSPSQTSSG
RSTPVPVKDRQKLGMEGGSRKPEAREAMVESIGALTRIPNFMAELFVNYDSEVDRADLCE
DMVGLLSRNAFPDSATWSTTNVPPLCLDALLGYVQFIAERLDQPPNYDNLPDPARLRSQR
QRKKVIIQGVAKFNENPKAGIAYLASHKIIEDPDNPQLVAKFLKGTSRISKRVLGEFISK
KSNEALLDEFIGLLNFDGKRVDEALRDLLGSFRLPGEAPLITRILTVFSDKYITKVKPSG
VADKDSLFVLTYAIIMLNTNLYNRNVKPQDRMSFEGFVKNLRGVNGGNDFDTDFLQSIYT
SIQHNEIILPDEHENKHAFEYAWKELLMKTMETGELAVFDSNVFDAEMFQATWRPVVATL
SYVFMSASDDAVFSRVVIGFDQCAKIAARYNQTEALDRIIYCLSSISTLAPDTPPNTSLN
TEVQAGKKSVMVSELAVKLGRDFRAQLATVVLFRVLMGNESIVRKGWTHIIKILHNLFIN
SLIPQFESMKPKLDVPPIPLQPPSQIIDRDGRGNDSGLLSAFTSYLSSYAADDPPEPSDE
ELENTLCTVDCVSACSIPEILTNISLMPLESVVSLVNALLSDLPDTSPAVIVVKPERPPP
NASRSPSSKTDADRPNYDPGMIYVLELATILTIRDQNTICELGETLTGALQNIVRDFKGF
HSLVVSRVISYLLSLLCHAYEYSFMRVPVVLHAISALDQNILENSAVTIVKGLSYCITSA
APLKSEITRSPDFWSILQRLHRHQEGAPMVFDLLEHIVHFTPPVISADNYESCVVLANDF
ANAGSLAAVSDPRRVLSGKRSMPVKAPKAQDNPLAQRGIQAIGLIYHLSKRVPDLIQQSH
LERNEAWAAYWSPVFNALTTQCLNPCRDIRHQAISALQRSLLSPELASTDHTEWIAIFGE
VLFPLILRLLKPEVYQSDPVGMSETRVQAATLVCKIFLHYLVLLSEWDGMLDLWLKILDI
LDRMMNSGQGDSLEEAVPESLKNILLIMADGGYIAPPTEDPSKEKIWVETQKRLDRFLPN
LFAEIPFKAEVQKPQPPQTPTQQEPTSSITPPELPPQPDHEESHSHPTANETLAKTDVLD
AVD
Download sequence
Identical sequences C0NFS0
HCBG_01736T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]