SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCDG_06810T0 from Histoplasma capsulatum H143

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCDG_06810T0
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily Mitochondrial carrier 5.1e-68
Family Mitochondrial carrier 0.00057
Further Details:      
 
Domain Number 2 Region: 472-513
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000863
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCDG_06810T0
Sequence length 569
Comment | HCDG_06810 | Histoplasma capsulatum H143 mitochondrial carrier protein (570 aa)
Sequence
MSTTAGAFIAGGLAACGAVTVTHSFETVKIRLQLQGELQSKREAVRKYRGVFHGVKVILQ
NEGARGLFRGIGSAYIYQVLLNGCRLGFYEPLRVNITQAIYKDSTHQSLGINVFSGAASG
VLGAAAGSPFFLVKTRLQSFSPFLPVGTQHKYRNSFDGLRQIYMGEGVKGLYRGVYAAMV
RTGFGSSVQLPTYFFAKRRLIKHLGMEDGPALHLASSTCSGFVVCCVMHPPDTIMSRMYN
QTGNLYKGVFDCLYKTISTEGVLAIYKGYFAHLARILPHTYNSLDGDSSDFISDLEHRLG
NSEIFPFRRNIPLFEKKADTMLRSGSSTARTVASKSQFPYGKFLKSENSEFLGFFSSRHQ
QFAVPCYTNISINPDSRSNVLGNYCKIKKNLRWLPKERVYAVCSGGPYLRGTVYGHLRKE
NGGESALVLSYAVEESVEVVERHRPDQSHWYNDESQMFHGWTSGFLFRNPAQETERKLGI
KLPADYEEFLSIMNGFEQSWGGIVLDSPLHPTTRIIYQSRTRASEVRARQIAKGWESNRD
RQPLADSSLEDPGRPISAGVMEMGNMTMS
Download sequence
Identical sequences C6HKS9
HCDG_06810T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]