SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28572183|ref|NP_788963.1| from Tropheryma whipplei TW08/27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28572183|ref|NP_788963.1|
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 5.1e-26
Family Thiamin pyrophosphokinase, catalytic domain 0.0034
Further Details:      
 
Domain Number 2 Region: 140-202
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000157
Family Thiamin pyrophosphokinase, substrate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28572183|ref|NP_788963.1|
Sequence length 230
Comment hypothetical protein TW008 [Tropheryma whipplei TW08/27]
Sequence
MLGMGVCYIYGAGEHFTPPEEVGMHDLVIAADGGLMQLKKHGARIDLYVGDLDSIESIPI
NIDRVILPREKDKTDMMQAALIGAERGFRTFCIFGGTGGRLDHTIGNIQLLAELTNMGYS
VFIVGKYDVVTAIRNNEIYFPSHFTGNISIFPHSGDASGVYEEGLKYALNNAHIPGTFNG
VSNEFIGVKSRVAVESGMLLVVYERQGGRMHLNISTCAMTAGNQIQKPSG
Download sequence
Identical sequences gi|28572183|ref|NP_788963.1| 218496.TW008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]