SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|28572605|ref|NP_789385.1| from Tropheryma whipplei TW08/27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28572605|ref|NP_789385.1|
Domain Number 1 Region: 6-257
Classification Level Classification E-value
Superfamily Cgl1923-like 4.97e-62
Family Cgl1923-like 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28572605|ref|NP_789385.1|
Sequence length 296
Comment hypothetical protein TW455 [Tropheryma whipplei TW08/27]
Sequence
MASFLDCRVLIAAFEDWGDAGKVSTTALRMLMEIFHAKPVKEIDADDYLDYHLYRPRCES
KDGVRKIYWPAPTVYKMSNEPGVPSGSAEDIYFLISPEPNMRWRKFAVEIVDYAKANNIS
GIIFLGSMLTDIPHTRPFPVFLTSEEPKVRYEIGVAKPSYEGPVSVASAIQEAARKELID
TLSLWAPVPHYTQGLPCPKALLALLVQVENLLSSSFTDQISLKAEVQKWEERVTQAASSD
PRLLEYIKQLEELQDRVALSSTANDHLVKSLERYLSSIRRESEEFPTISRLRELPE
Download sequence
Identical sequences 218496.TW455 gi|28572605|ref|NP_789385.1| WP_011096403.1.1961 WP_011096403.1.2273 WP_011096403.1.30872 WP_011096403.1.3524 WP_011096403.1.35576 WP_011096403.1.36967 WP_011096403.1.41189 WP_011096403.1.42537 WP_011096403.1.52318 WP_011096403.1.64596 WP_011096403.1.68459 WP_011096403.1.7325 WP_011096403.1.77801 WP_011096403.1.80906 WP_011096403.1.86550 WP_011096403.1.87151 WP_011096403.1.88484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]