SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCEG_01740T0 from Histoplasma capsulatum H88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCEG_01740T0
Domain Number 1 Region: 154-420
Classification Level Classification E-value
Superfamily Kelch motif 7.59e-58
Family Kelch motif 0.00045
Further Details:      
 
Weak hits

Sequence:  HCEG_01740T0
Domain Number - Region: 100-139
Classification Level Classification E-value
Superfamily Kelch motif 0.0418
Family Kelch motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCEG_01740T0
Sequence length 1475
Comment | HCEG_01740 | Histoplasma capsulatum H88 kelch repeat protein (1476 aa)
Sequence
MAFLFKSKKSQAANNSLPPAARTIHTSEGTAQGSPSAPPNGVRDGGPVQSPSYGSADNSL
NSLSGTGPRTQVPNGNNAPSPVPNPALFPWSQRRMNFPQNSRPFPRYGAAVNGVASKDGD
IYMMGGLVDGTTAKGDLWMVESNGGNLSCFPINPVTEGPGPRVGHASLLVGNAFIVFGGD
TKTDDNDTLDDTLYLLNTSSRQWSRAVPPGPRPAGRYGHTLNILGSKIYIFGGQVDGFFF
NDLVAFDLNALQNPSNKWEFLIRNSHDGGPPPGKIPPARTNHTIVSFNDKLYLFGGTNGL
QWFNDVWCYDPRTNLWAQLDYVGFVPAAREGHAAALINDVMYIFSGRTEEGADLADLAAF
RITTRRWFSFQNMGPSPSPRSGHSMTSFGKQIIVLGGEPSTAPRDPEELSLVYVLDTAKI
RYPAEPSPTSPTGNASRKLGQADRPSASGRTSREAQNSTPDLHGRRGPSSGRESATAGRP
DVSSPGPGATGSRLPRASIAQAPAGPPPPGQAPTPTPRAPNINTQSGRSKPHKGGERGMT
PVDNLRTVGNEKDRQSPVMREMMTNSRPGREQSPVSGGRQQSSRLSARAMEAGEAAPLVT
PARQRSLRQKHHNSIDSVDDSILGKGPGSADGSEQRIYRNSRNFNDEPRSPRLTPHQEAL
IKDLEAAKARNAWYASELAMARKAGYTLNPANASPLDQRSIDIFKEEDRPLIEAFISMRA
ELAKMQAAVDRQAAIASKRVAEVEHQRDAAINEAAYAQAKLAAQGGRRGTPQSDRNGRDV
DETNPDRSAEISRRLALALASQAELKAKTETLMSELQDERRAKELAEELHEVTSKRLSEM
ESQNNNLELESLRTELHHLQSAFREEAALRSEAESALKLTQIDKSELSQKVDDLNSRLEN
HGTDVGSLREAVNASSAKAELLERQLEEERDHREGLERKLLQLRAEHEERTTELENTARR
LRDAEELAETHAREAESHRAAFLAGLDRASSRDSESTAKSLAEQRVAALKEQVDRANELV
KTNHQAANEASEKLRRAEERIAGLEQYQEQASREGLQLRRQLQTALKESQALSNENREVK
AQLENHQRDANALAIQHGALKELLGERGITADNRRSPLLDSPGSRFGTPEHNRLRELEQQ
LQSSIKAHEETKLSFESREQEADRAYNEKLEQLENDYQSAVHYVKGTEKMLKRMKDELSK
YKSQNSKLQTELETALQKTNSTSSPSPEASARWETERLDLQKSLSDLQERTSTSIANLEA
QLAKLREDLTATQAERDQSLSEQDNIKRELLSITEKSREDLEQLKSENALLESRALDAEQ
KISMLLDQVESSVTNYRRQSQQVLSHPNGLSRTISNASSNNTIGARPRADSNVSQDDSFL
DHRSSFALDSLASELDALRSHWESTNRNYRLSTQFDFDRTPTKETYGESGLSDNLASWRK
RLDEEERSSTPVKAPTSAALAPPAAPAQPTIGNMI
Download sequence
Identical sequences F0U707
HCEG_01740T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]