SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCEG_03745T0 from Histoplasma capsulatum H88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCEG_03745T0
Domain Number 1 Region: 113-253
Classification Level Classification E-value
Superfamily PH domain-like 6.04e-48
Family Ran-binding domain 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCEG_03745T0
Sequence length 261
Comment | HCEG_03745 | Histoplasma capsulatum H88 ran-specific GTPase-activating protein (262 aa)
Sequence
MTDITNAKPEDPTTTTTDAAAAPEEEKPADAPPAEEPKPDTEKEVAAAADDDAKKDAEGG
DNKPPTTTSDSVFSMFGGGPKRERKREDDEDEDEPSGSSKAKKDGEVAEEEEADVHFEPV
VHLTEKVEIKTNEELEEQTFKMRAKLFKFDRSSREWKERGTGDVRLLKHKENQKTRLVMR
RDKTLKVCANHYIVPDMKLAPNVGSDRSWVWNAAADVSEGEPEAQTLAIRFANSENANLF
KEAFEKAQQENEKLFAAGASE
Download sequence
Identical sequences F0UE00
HCEG_03745T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]