SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCEG_05665T0 from Histoplasma capsulatum H88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCEG_05665T0
Domain Number 1 Region: 90-369,439-486
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-38
Family Kelch motif 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HCEG_05665T0
Sequence length 656
Comment | HCEG_05665 | Histoplasma capsulatum H88 kelch repeat protein (657 aa)
Sequence
MGKSDKKSKTAEKKARVAAKQSKKLAQKEKKLKAKGQADDSDAEDVDLDAVLAAYAEEQA
KFLKVTEVSCGPPSPRSSSTLIASPARRSELFLFGGEYFDGTIATFYNNLFVYQADKHEW
REVTSPNSPLPRSGHAWCRGGNAGEFSSPKQGTFYHYNDFWHLDPSSREWSRIETKTKGP
PARSGHRITYFKNYILLFGGFQDTSHQTKYLQDLWIYDCQKYTWHNVILPPASQKPDARS
SFSFLPHEFGAVLYGGYSRVKMSAAANKQQKGGAQRMILKPIVHQDTWFLRITPPPSDAP
STAMPTIRWERRKKPANPPNPLRAGATMAFHKGRGIMFGGVHDVEATEDGIESEFFDSLH
AWNTDRNRFFQLALRRPRATGKKQQAAMKTEKRSRGKADEEDLLRNLALVETKAIESQPM
DIDSPENEDEDNGEKRNLTVRFEMPHRRFNSQLTVLDDTLFIFGGTFERGDQEFTFNDMY
SIDLVKLDGVKEIFYNEPEHWNDAIPVDTDEEDEEEEESDDGENEDIEMESVEVASTAAT
SVTEPAQMETEVEQESETPAQDSRPHPRPFESLRDFFNRTSSEWQDILICKMNTAKSGSE
MSIKELRKEAFALAEEKWWDCREEITALEDEQEEAGIGEVVSMADRSDVPTAGRRR
Download sequence
Identical sequences C6HJK8 F0UIQ1
HCDG_06389T0 HCEG_05665T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]