SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HCEG_07803T0 from Histoplasma capsulatum H88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HCEG_07803T0
Domain Number 1 Region: 624-668,707-786
Classification Level Classification E-value
Superfamily PH domain-like 4.55e-26
Family Ran-binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HCEG_07803T0
Sequence length 789
Comment | HCEG_07803 | Histoplasma capsulatum H88 nuclear protein export protein Yrb2 (790 aa)
Sequence
MASEKHQQNGVLIGEDTSSTPPAATDPEPRSPALDIVEPTDKDSHSPLLPGTQGTQERGP
VSPLETRDKRDLVSLSDSKNSEASNTVDVGTLPGPRLTPQQGTRDNTSSPNIARERNGGD
GQKARPQEMPHQQAEEKATDKNHVEKSFSDTDEGPTLLRKDNGARTENDAAELSEGTKTQ
EPEEVKINYPASDEQKDGAGERPVRQKLKETSIAGVPRPNSPEDHAMASQGTPVARADSV
SDTSSVEGRGRLRRKRSLGDMNEDEEHGEAAGGKNTDETGHRRKRSRDSKTDDESSDNQG
RSKSKSTTEDEHGMTDDMDAKDVTNKGGIRTPTEELKSTESDTANRILSPKKKRSRDQFD
KDHLKPDSMDEKAEEGTENAKFREPFDKSKAMSANRTVEGEPEKKRHRDDSQDRSSQVDS
DLVSKKASSLNPFSNTLSVSAFASMASKTPQLTSKDKMEKKEQPMTSASAFASSKLASFA
SSEKSPFSSLGAANSSALKSAPPAETTRGKEHPSTSSSAFAASPFAAAAASSPFGALSSG
KSGFGRSGFATGFAAAAPKLGGGLAAFSTPTGSSSVLGNSSKSKTLGAAGSAHEDGNKVE
KGTGEDDDKSTFEGLEEEKGDERFHEQQTETGEEGENTIFSCRGKLYHFNGKEWKERGVG
VFKVNIREPVNHGNNTDGSEEEPQPGDNKTDEEHEKEEKHKANEDEGVEPKKKTARVIMR
ADGVWRVILNIPVFKGMKAGDPSGGPPKGKQVHFAGFEDGKSVPFLFKTGNDDIAKQLYT
TLHTLQASL
Download sequence
Identical sequences F0URR1
HCEG_07803T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]