SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|452205823|ref|YP_007485952.1| from Dehalococcoides mccartyi BTF08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|452205823|ref|YP_007485952.1|
Domain Number 1 Region: 321-478
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.03e-27
Family HD domain 0.027
Further Details:      
 
Domain Number 2 Region: 216-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|452205823|ref|YP_007485952.1|
Sequence length 527
Comment ribonuclease Y [Dehalococcoides mccartyi BTF08]
Sequence
MFEFFMETAPATTTGLPLSAILAIFFSFIIGIVFGGMALFVFRGFIMNRQLRIAQRKATK
MLADSKLEAKDVLVEAKREADKTRNSAETELKERRSELAKQENRVIQKTEALDRKLENLE
QREQSLTNREKSIDETQSQIEEIRENELKRLEEVANMTTEQAKTSLLEMLEGEMQQETSR
RLREWEIKIKAEADEKAREVVSQAIQRCASDVVTETTTNVVPLPSDEMKGRLIGREGRNI
RALEQATGVDLIIDDTPEAVTISSFDPVRREVARQALSKLIIDGRIHPARIEEVVTKAKE
EVEAAMIASGEQAAYQAGVHGLRPEIIKVMGRLKYRTSYGQNVLQHSIEVAQMSGMIGSE
LGVNVTLARRAGFLHDIGKAVDRDVEGTHTQIGADMVKQWEKSPEVIKGVAEHHFDTPTV
SIWGFIVSAADAISSARPGARRESLENYIKRLKALEEIADSFKGVEKSFAIQAGREVRIM
VKPDEIDDLGAMRLARDIVKRIEDGLEYPGQIKVTVIRETRSVDFAK
Download sequence
Identical sequences A0A142VC23 A5FPE4 Q3ZW82
216389.DehaBAV1_1354 255470.cbdb_A1702 gi|147669991|ref|YP_001214809.1| WP_011310043.1.17753 WP_011310043.1.45256 WP_011310043.1.48192 WP_011310043.1.52557 WP_011310043.1.55841 WP_011310043.1.5855 WP_011310043.1.62194 WP_011310043.1.66924 WP_011310043.1.67918 WP_011310043.1.74482 WP_011310043.1.75083 WP_011310043.1.79047 WP_011310043.1.83924 WP_011310043.1.84634 WP_011310043.1.89941 WP_011310043.1.91135 WP_011310043.1.92458 gi|73749382|ref|YP_308621.1| gi|452204290|ref|YP_007484423.1| 2013897385 gi|452205823|ref|YP_007485952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]