SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392374694|ref|YP_003206527.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392374694|ref|YP_003206527.1|
Domain Number 1 Region: 4-201
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.41e-41
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|392374694|ref|YP_003206527.1|
Sequence length 224
Comment hypothetical protein DAMO_1638 [Candidatus Methylomirabilis oxyfera]
Sequence
MIYLIVLVSVGAKAADAAPVAYVTNSGSANVSVVDTATKAVLTTISVGLTPEQIAITPNG
ARVYVTNSGSNTVSVIDTATNAVVGSPISVGSNPVGIAITPNGARVYVANFVDNTVSVID
TATNAVVGSPISVGQRPDFLAASPDGASVYVPNQGSNTVSVIATATNSLVGSPISVGTAP
TGIAFSPAGIPIIPTLSDSGLLLLFVAVATTLTLRIARRSIVSQ
Download sequence
Identical sequences D5MG15
gi|392374694|ref|YP_003206527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]