SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392375456|ref|YP_003207289.1| from Candidatus Methylomirabilis oxyfera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392375456|ref|YP_003207289.1|
Domain Number 1 Region: 38-406
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.31e-66
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392375456|ref|YP_003207289.1|
Sequence length 409
Comment heme D1 biosynthesis protein (nirF), involved in nitrite reductase biosynthesis [Candidatus Methylomirabilis oxyfera]
Sequence
MERKTVVRVRIFRFAVKAFLILLALSLPLHSSADERRWGTASLVVVIERQAGSVLIIDSS
RHELLGRISGLGNLTHATVKFSPDARYAYVIGRTGEVSKIDLLTLKLVKQVNAGKLSVGG
VVSQDGKYVALSNYVPGEVRILDADTLELVKTIPALYTDASEKGREQLPSRVAGLVDAPG
NLLVFSLMDGNSIWVVDAGKKEFPVIRKFPDVGKMPYDALISPDGRYYLAGFLDSNWMGL
LDTWKLDRVAPILAEQGKGPDVPLWKIPHLKGWALTGRLAFLPALKREVALVYSTLDWTP
LTPVPISGTALYTVVRPDGRQVWVDIIGKNGDLIDVIDVDSMKVVKTLNPGAGATHPQFT
PKGEAAYVSLMDGGKVVVYDTATFQVLKEFPADHPSGIFFANRAHKFGM
Download sequence
Identical sequences D5MIV3
gi|392375456|ref|YP_003207289.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]