SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|556566149|ref|YP_008734574.1| from Actinoplanes friuliensis DSM 7358

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|556566149|ref|YP_008734574.1|
Domain Number 1 Region: 155-240
Classification Level Classification E-value
Superfamily Lysozyme-like 3.94e-17
Family C-type lysozyme 0.01
Further Details:      
 
Domain Number 2 Region: 78-141
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.76e-16
Family alpha-D-mannose-specific plant lectins 0.0011
Further Details:      
 
Domain Number 3 Region: 29-98
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000288
Family alpha-D-mannose-specific plant lectins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|556566149|ref|YP_008734574.1|
Sequence length 258
Comment hypothetical protein AFR_16195 [Actinoplanes friuliensis DSM 7358]
Sequence
MAAAGVVTALLTGTAVVTAGPAQAASADRLTPGRTLTPGAELRSANQRYRLVMQTDGNAV
VMTAGGTPLWSSDTPGYGGAALEMQNDGNLVLYKSGHVALKASGTAGRQSASLVLQDDGN
LVVYTSDGRPWWSTNTSGGAKAPAPTGARLCARVGYYAGFREQGLQLAVQVALAESGCNP
AATNRNTNNSVDYGLWQVNNRAHPQWTPSQLLDPQTNANAAWSISGRGGNWRPWVAYTSG
AHTRNGIPAKANAAVTQL
Download sequence
Identical sequences U5W0P7
gi|556566149|ref|YP_008734574.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]