SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16081425|ref|NP_393763.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16081425|ref|NP_393763.1|
Domain Number 1 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-18
Family GHMP Kinase, N-terminal domain 0.0046
Further Details:      
 
Weak hits

Sequence:  gi|16081425|ref|NP_393763.1|
Domain Number - Region: 211-244
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00911
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16081425|ref|NP_393763.1|
Sequence length 268
Comment shikimate kinase [Thermoplasma acidophilum DSM 1728]
Sequence
MKYARVRTHGGVSIISAFIDGMGGAFSIDVPMTVTVREGTCSEEKKISEDIRRYLSIATC
FRFTVDSRIPSGYGLKSSSAYILALAKAMAVYSGIDISDMEIMTASADISKNSGLSMTGA
LDDLCQAMYGGYCLTDNRKMKILRRGRLPEMPVLVCADGDKRSSGKVSIEGHFTNAIRRV
EDLAFKGRIFDAAVANGLIYGSIFGMDLRLIGSMLKAGALYSSQSGKGPAIFGIFADRRS
AMNARSDIGFGIVTKINNQGIRYWKYDS
Download sequence
Identical sequences Q9HLE5
gi|16081425|ref|NP_393763.1| WP_010900712.1.49201 273075.Ta0283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]