SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16081554|ref|NP_393910.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16081554|ref|NP_393910.1|
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.43e-35
Family Translational machinery components 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16081554|ref|NP_393910.1|
Sequence length 129
Comment 30S ribosomal protein S9P [Thermoplasma acidophilum DSM 1728]
Sequence
MITTGKRKTAVARAVAKKGKGIVTINGYPVELYPVRVLRNKIMEPLLIAEDKAKDLDIAV
KVRGGGVTGQADASRTAIARAIVKYLNDTELENLFRQYDRTLIVNDVRIKLPKKAGGRGA
RAKKQKSYR
Download sequence
Identical sequences Q9HL08
273075.Ta0432 gi|16081554|ref|NP_393910.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]