SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16082254|ref|NP_394707.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082254|ref|NP_394707.1|
Domain Number 1 Region: 40-111
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.88e-21
Family Ribosomal S5 protein, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 124-196
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-17
Family Translational machinery components 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16082254|ref|NP_394707.1|
Sequence length 221
Comment 30S ribosomal protein S5P [Thermoplasma acidophilum DSM 1728]
Sequence
MSEEWVPKTQLGKLVASGQIKTMGEALRSKLPLKEYEIVDYLLPNLKDEVIDIKRAQRMT
DSGRRMTYSITVVVGNGDGYVGLGIGRSKEAAPAIRKALINAKLNIMEIRRGCGSWECGC
GRAHTLPFLVQGKSGSVRITLKPAPRGVGLAVGDVARTILSIAGIEDAWGFAAGHTKTTV
NYALAVYNALKETSKVRINPGIVLSTPIYSGSVVNVSGHKD
Download sequence
Identical sequences Q9HIS7
273075.Ta1251 gi|16082254|ref|NP_394707.1| WP_010901658.1.49201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]