SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16082295|ref|NP_394760.1| from Thermoplasma acidophilum DSM 1728

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16082295|ref|NP_394760.1|
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000047
Family GHMP Kinase, N-terminal domain 0.006
Further Details:      
 
Domain Number 2 Region: 191-299
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00000734
Family Mevalonate 5-diphosphate decarboxylase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16082295|ref|NP_394760.1|
Sequence length 318
Comment hypothetical protein Ta1305 [Thermoplasma acidophilum DSM 1728]
Sequence
MTYRSIGSTAYPTIGVVLLGGIANPVTRTPLHTSAGIAYSDSCGSIRSETRIYADEATHI
YFNGTESTDDNRSVRRVLDRYSSVFEEAFGTKTVSYSSQNFGILSGSSDAGAASIGAAIL
GLKPDLDPHDVENDLRAVSESAGRSLFGGLTITWSDGFHAYTEKILDPEAFSGYSIVAFA
FDYQRNPSDVIHQNIVRSDLYPARKKHADEHAHMIKEYAKTNDIKGIFDLAQEDTEEYHS
ILRGVGVNVIRENMQKLISYLKLIRKDYWNAYIVTGGSNVYVAVESENADRLFSIENTFG
SKKKMLRIVGGAWHRRPE
Download sequence
Identical sequences Q9HIN1
WP_010901711.1.49201 273075.Ta1305 gi|16082295|ref|NP_394760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]