SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbg972.7.6450 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.7.6450
Domain Number 1 Region: 280-658
Classification Level Classification E-value
Superfamily SIS domain 3.15e-93
Family double-SIS domain 0.000000851
Further Details:      
 
Domain Number 2 Region: 2-260
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.43e-52
Family Class II glutamine amidotransferases 0.00000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbg972.7.6450
Sequence length 659
Comment | organism=Trypanosoma_brucei_gambiense | product=glucosamine-fructose-6-phosphate aminotransferase, putative | location=Tbg972_07:1563531-1565510(+) | length=659
Sequence
MCGIFGYILHRIPCTTRDVLNVLLDSLQRMEYRGYDSAGLCVDDVKSKKHIVVRSVGNIS
KLRERVFSGCADLDFNAQLENHEGIAHTRWATHGPPSEANCHPQASNNMEFVVVHNGIIT
NFMTIKQMLLEEGYHFSSDTDTEVIVVLAEHIFSKDHSISFADLAGKVMAELDGAYALLI
KSVHFPGELIACKEASPLVIGLQNGKSNGTASGIANGSVMNKLFFSSDVASFLPYTQEVI
FLEDGDVAHYSKGALTLYNDATPVSRTSQTVDVSPEGLCKGAYPSFMLKEIYEQPESVSR
SMRDRIDFNTREVTIKEMSDGVRTTLLSARRLMLVACGTSFHSCVAARPIFEELLPNISI
TLENAPDLLDREPRIGSDDVCVFVSQSGETADTLMALQYCKKYEAMIVGLTNVPGSSVLR
LSDFALLLNAGVEVGVASTKAYTSQVVVLTLLALFLSKENCSGNSSHSHGGSQSPIQKRR
LEIIDGLAALPGALSHCLKCTNDVATKLAEELCDAKAILILGRGYDYATALEAALKVKEL
TYIHTEGIHCGELKHGPLALVDEHSTIVAFCPHDKFLGRSKSAIQQVKARGGRVVAITTE
PDAELVSATSRCVEVPAIVDCLQGIVNVVPLQLLAHHLAVRRGLNVDCPRNLAKSVTVQ
Download sequence
Identical sequences C9ZTL6
XP_011775031.1.14543 Tbg972.7.6450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]