SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.1640 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.1640
Domain Number 1 Region: 37-318
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.52e-39
Family WD40-repeat 0.001
Further Details:      
 
Weak hits

Sequence:  Tbg972.8.1640
Domain Number - Region: 370-432
Classification Level Classification E-value
Superfamily SIS domain 0.00945
Family mono-SIS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.1640
Sequence length 477
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_08:483620-485053(+) | length=477
Sequence
MQNKSWALPIKQVPVVEKLDRSIVWNNVRLCYEQKLFGQISCIRYNNAGTVVGCASTNQL
SLLRVPQTEGVITNEQRERKCFSLRFRDDDKMTIMSVDQRVVIRSTETLFERQFPGHVRE
VRDALFLDRRSFVSGSDDTTIKLWDVMGECELAVGKAHTDYVRCLENRSPGCFFSGSYDH
VINLWDTRAGFSCPTQTSGQAVPNPVESLLCLDTNLLVCGASDQIILFDIRKGLSLPLTQ
DSYHTKTVVALGYSKKYNVLLSGSLDQRVKIFSLERGCPDPVASKKFDAPVTAVAVHPRS
SEFAVGTASGDLRIMKLGSASDGDEMGGGKDEESRGRPKDEGLIAMKVNDVRRQLVSYQY
NRALKTALYSRHADVVVSTLEELLRRGALHVALSGQNDRTIARILRFALGFIDTPQFSES
MMVVLDTIFDIYGTCVGKSIFLHRELMKAHRRLGSVLANLQRMAGTLSIMELIVNDV
Download sequence
Identical sequences C9ZUX6
XP_011775491.1.14543 Tbg972.8.1640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]