SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbg972.8.1470 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Tbg972.8.1470
Domain Number 1 Region: 709-742,771-933
Classification Level Classification E-value
Superfamily Sec7 domain 3.27e-42
Family Sec7 domain 0.0000818
Further Details:      
 
Domain Number 2 Region: 411-547,1073-1090,1135-1203,1380-1506
Classification Level Classification E-value
Superfamily ARM repeat 0.0000047
Family PBS lyase HEAT-like repeat 0.077
Further Details:      
 
Weak hits

Sequence:  Tbg972.8.1470
Domain Number - Region: 146-363,419-598
Classification Level Classification E-value
Superfamily ARM repeat 0.0518
Family MIF4G domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Tbg972.8.1470
Sequence length 2063
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_08:448586-454777(-) | length=2063
Sequence
MQLAPNKTVVDLENRATFMVQLHAFLLQARHVVSGTPKGKLQEVLRNVDEWIKEVSLGDA
TTSSGSASGNASVTERTGGEASGPLRQGASEADTGAAEDPKPPPNSSPSASPCEDPSPAT
AVAAEGDERGQLVHPDPNAGFSSDLSKRNLEDLARFLATLFVGTSSENGKLRNIARNAAR
IVITRCFSIIDNTLRQVLREVYDDPTANNGGEAGGNGAARRKESNPLFVSLGHDINVCRN
TIGICVDTLSGSTDFPSVRFAVQVCIDILKQLRQCVVHFERQFASREIGHIQDMVEATGN
GHNGEVRAADDEEDRCMAEQRVEELKRLLGPTLLESITHLVGLVRPVVGYLFSIVSVKSA
TASEDERTTKSDVVSNLFGLAKWYGRTSHLSRCGDASVDDSVTLSRSTEFDDNVPIHSRS
HRILCCVLESVLATSFSPEYTACVAQHCGDRAEGQFLAVRLLKDTVSELCEGSAAELEYV
LRHDNWRKRILDGIFNCVMSLRPSVLDAGLETLRRVVTSCPDCLSTEVGSIYCNGIFGLL
GSDSTPPFMQRSFLHHIIDTFFQGSAVSGEAPLLLRCYRRFDLNVHWHQLNLIQKVVTVL
SRAVCTARPEEFVDIEGPKPRASGTASGSAAGNAEASNESIVYAETGGGDSANVTQTVNC
ASFVDDGTVMMQRSMPFLALHGLALVVEILTKQIPQNTGLSNWKPLPRLLNRKKKIEQLH
FVEAINSSPIKGLRKLFNIRDEEWQTEADRAIAENNWSHRHIPEPATPQAEEKVQHIAQF
LMETPSLNSDAVAEILSYPAVISLQVCRAFMDLLPLAGKTLINGLRELFRVVKLPKEGQR
IERLIEFFCSAYYKAGSRSCVDTDVFPFASEDACFIAGIGIIMLNTNLHNPNVSTTKMTA
ASFYAQMRGCNDNKDFPRRFTDSVFEEVSTRSLSNVHESMLTEAKRRGSVVSHMRMDAFF
FTSEDRKEAEFNVVRRRLTDETRELLFRSSRLCEDDGEIREGGDTEQEYWTSVTQDLFLS
TWPSLNAVFGAAVDGNQIPEDALLLYATGLRSSLLLSAAFGLHTECDAAQMALVRLSAFD
SLRDVCHGCLLEVASSRHSVHFSSRCWLPVVELLVTIRKEQSQTQSQQSYQQQSQSQQQQ
RRAILVQMESLFGHLEEITREYCNMSVHEAPPVIVVAVRELLQGVAALLRDQGMDFPTLT
AALYVVRRVLSYSVISHDQELGPVVTNLINVRDLSGIVMPALVDVVEARREKGDECLHAV
TSFVVDVLSVVWNSCVRDANCSHQAVKLTELANCFCFFQMCHERCVNSSVVQMHMLQGVK
ELVSCTVLAESSVKQRTTRGVQTRVSFTMALVWERLLHSVAHALSGKSTVGTETCSLAVH
VLQKLVLICCGAGSVPPSVQMRQEPLNVLLSLLCNVAYVGGMCSDVESAQSCLAQLSCVC
TAALNREVTTSLEATAVTSDEDDYEVDGLNEVQVQLTRRLLQGIQGQDDFTVLHALERIC
MLLGCHTQETRTEAIGVLRAVSKQLCVRDQKQHLAVQLADTVLQVLLGHTAPGSKSSANT
PEAAEDVGRVSFAILNLRTPPTMRKCPAVAFHATLPQLLNFMSHELIVDASLEDVASLGA
VVMERCLLPLAVSPKSSSHVRPLAVRSMMQCATLCVAALGKLSESSAAREKAAGDRCLNA
IINSVSLVLLDTHLFKQSIVPHNAQYVGSRWDAGLSQMLGAYSKAGRSAIRALSASDPCN
ITGSRGCVTLSMRMLHEEQVSEHSKVAPNDLPGKKQGTVAGCEEGLSSGTDSTVLSDEQL
VEYCNLMAPLLSPLPKVLAAITPAMYTRSERPFSGDEGAGTTEGCEQPVWWSPPPCNYKL
MAELLLDAEGAFFAVLWRVNHASEMDQFVMQSVTKGREATPLSKSSALLPHTAVRGGLNA
YLSLALQMDFSHLRHVLVEILEEVAFVQSLSSGSRKPRRTGDSMSDSPVGQQLSPREQQH
VRSCNVGMYQELTSVVVHWVKNLMYQLAPETSALTGQRQSELADVVRDPEVFKGLVQLLT
AAGGSIVSTVRDYLTWYIEAQQR
Download sequence
Identical sequences C9ZUV9
XP_011775474.1.14543 Tbg972.8.1470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]