SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Tbg972.9.5050 from Trypanosoma brucei gambiense v4.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Tbg972.9.5050
Domain Number - Region: 11-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00915
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Tbg972.9.5050
Sequence length 84
Comment | organism=Trypanosoma_brucei_gambiense | product=hypothetical protein, conserved | location=Tbg972_09:1116350-1116604(-) | length=84
Sequence
MSYQSSEAKKEEFRKYLEGKQVIDTLTRVLVNLYEEPEKPDDPVDFIKKVLGGASTADYE
ALQQENACLKAEVAALKKRLNEEH
Download sequence
Identical sequences A0A1G4HYL6 C9ZYD0 Q38E79
XP_011776695.1.14543 XP_827221.1.54365 gi|71745182|ref|XP_827221.1| Tbg972.9.5050 5691.Tb09.211.0775 Tb09.211.0775 Tb427tmp.211.0775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]