SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28210710|ref|NP_781654.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210710|ref|NP_781654.1|
Domain Number 1 Region: 11-285
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.1e-42
Family ROO N-terminal domain-like 0.0000732
Further Details:      
 
Domain Number 2 Region: 253-396
Classification Level Classification E-value
Superfamily Flavoproteins 1.93e-33
Family Flavodoxin-related 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28210710|ref|NP_781654.1|
Sequence length 397
Comment flavodoxin [Clostridium tetani E88]
Sequence
MIGGYNMSSFKIRDNIYSVGVKDPDLRVFDIIMETNGGTTYNSYLIDDEKVAIIDTVKDG
FYDKFYSNIKEVIGERKVDYIIVQHTELDHSGSLINLLRDYPEAQVICSMAASVYLKNIL
NKEFNHQVAPKELSLGNTTLNFITAPNLHWPDTMFTYVPEKKALFTCDFLGAHYCPSTNI
FDGESEDSYEEMVYYFDVIMSPFKKFVLAGLDKIKDLDFDLVCTSHGTVHTKENIKKYMN
MYREFATGNNEEEKKIEIFYISAYNQTKAVADYFYKQLNNMGIKADIHEITESGIDKCAE
LIEKSKGFLIGSPTINQDAVKPVWDVLSLVSPIVNRGKPAGAFGSFGWSGEGVPMMTERL
KSLKLKVVEEGFKFKFVPSSEDYKNADTFLEDFKNLL
Download sequence
Identical sequences Q896J9
212717.CTC01004 gi|28210710|ref|NP_781654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]