SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28211064|ref|NP_782008.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28211064|ref|NP_782008.1|
Domain Number 1 Region: 4-291
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 5.46e-50
Family ROO N-terminal domain-like 0.0000371
Further Details:      
 
Domain Number 2 Region: 252-397
Classification Level Classification E-value
Superfamily Flavoproteins 5.16e-24
Family Flavodoxin-related 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28211064|ref|NP_782008.1|
Sequence length 399
Comment flavoprotein [Clostridium tetani E88]
Sequence
MYCVRKITEDLYWVGGNDRRLALFENIHPIPKGVSYNSYLLLDEKTVLFDTVDWSICRQF
IENVKGVLGNKPLDYMVINHVEPDHAACVEEIILRYPDVKIICTEKALMFMNQFGFNIDE
KVIEVKEGDTMSFGKHQVVFVSAPMVHWPEAMVTYDTTEGILFSADAFGSFGSLDGKLFN
DEININRDWIDEGRRYYTNIVGKYGAHVQSLLKKAADLDIKIICPLHGPVWRNNLDYLLD
KYDKWSSYEPEEKGVMIVYASMYGNTEAAANDLATRLVEKGMTNVAMYDVSKTHVSYLIS
ETFKYSHVVLASVTYNLNIYPPMFNYIMDMKALNLQKRTFALIENGSWAPQSGQLMYKLL
DEMKEMTILDNEISLNSTIKKDDMDSIEELAQNIIESMN
Download sequence
Identical sequences A0A1T4PNS5 Q894Z5
WP_011099607.1.12609 WP_011099607.1.27827 WP_011099607.1.49058 WP_011099607.1.81004 WP_011099607.1.83101 WP_011099607.1.96257 gi|28211064|ref|NP_782008.1| 212717.CTC01386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]