SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28211481|ref|NP_782425.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28211481|ref|NP_782425.1|
Domain Number 1 Region: 8-283
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.29e-54
Family ROO N-terminal domain-like 0.000000816
Further Details:      
 
Domain Number 2 Region: 249-395
Classification Level Classification E-value
Superfamily Flavoproteins 4.66e-34
Family Flavodoxin-related 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28211481|ref|NP_782425.1|
Sequence length 395
Comment metallo-beta-lactamase/flavodoxin domain-containing protein [Clostridium tetani E88]
Sequence
MSFKVTNKVTWVGKIDWELRRFHGDEYSTHRGTSYNSYLIKDKKIVLIDTVWEPFSKEFV
ENLKKEVDLNKIDYIIMNHNEIDHSGALPLLMKEIPNTPIYCTADGAKILKAHYHKDWNF
VEVKTGDTLDIGESKLTFVEAKMLHWPDSMFTYMSGENILFSNDAFGQHYASDLMYNDLV
DQAELYQESMKYYANILTPFNSFVIKKIEEVLALNLPLNIIATSHGVIWRDNPAQIIEQY
IKWANGYEENQITVLYDTMWNGTRRMAEGIAEGIKSVNKDITVKLFNAAHSDKNDVITEI
FKSKVLLVGSATVNKSIMSATAGILDMIRGLGLKNKKAAAFGAYGWSGEAVKILEEKLKN
GKFEILESGIKELWNPDKDAMNRCRQFGKNIVEKL
Download sequence
Identical sequences A0A1T4KP12 Q893I0
212717.CTC01843 WP_011100022.1.12609 WP_011100022.1.27827 WP_011100022.1.49058 WP_011100022.1.81004 WP_011100022.1.83101 WP_011100022.1.96257 gi|28211481|ref|NP_782425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]