SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28373188|ref|NP_783831.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28373188|ref|NP_783831.1|
Domain Number 1 Region: 2-555
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.24e-199
Family Clostridium neurotoxins, catalytic domain 0.000000000215
Further Details:      
 
Domain Number 2 Region: 559-884
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 2.62e-116
Family Clostridium neurotoxins, "coiled-coil" domain 0.000000164
Further Details:      
 
Domain Number 3 Region: 1112-1314
Classification Level Classification E-value
Superfamily STI-like 2.75e-68
Family Clostridium neurotoxins, C-terminal domain 0.00000000213
Further Details:      
 
Domain Number 4 Region: 882-1096
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.45e-43
Family Clostridium neurotoxins, the second last domain 0.00000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28373188|ref|NP_783831.1|
Sequence length 1315
Comment tetanus toxin tetX [Clostridium tetani E88]
Sequence
MPITINNFRYSDPVNNDTIIMMEPPYCKGLDIYYKAFKITDRIWIVPERYEFGTKPEDFN
PPSSLIEGASEYYDPNYLRTDSDKDRFLQTMVKLFNRIKNNVAGEALLDKIINAIPYLGN
SYSLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDN
KNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLH
GLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYK
AIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTE
IELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNT
NAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAE
KNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAP
EYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTLQRITMTNSVDDALINSTKIYSYFPSVI
SKVNQGAQGILFLQWVRDIIDDFTNESSQKTTIDKISDVSTIVPYIGPALNIVKQGYEGN
FIGALETTGVVLLLEYIPEITLPVIAALSIAESSTQKEKIIKTIDNFLEKRYEKWIEVYK
LVKAKWLGTVNTQFQKRSYQMYRSLEYQVDAIKKIIDYEYKIYSGPDKEQIADEINNLKN
KLEEKANKAMININIFMRESSRSFLVNQMINEAKKQLLEFDTQSKNILMQYIKANSKFIG
ITELKKLESKINKVFSTPIPFSYSKNLDCWVDNEEDIDVILKKSTILNLDINNDIISDIS
GFNSSVITYPDAQLVPGINGKAIHLVNNESSEVIVHKAMDIEYNDMFNNFTVSFWLRVPK
VSASHLEQYGTNEYSIISSMKKHSLSIGSGWSVSLKGNNLIWTLKDSAGEVRQITFRDLP
DKFNAYLANKWVFITITNDRLSSANLYINGVLMGSAEITGLGAIREDNNITLKLDRCNNN
NQYVSIDKFRIFCKALNPKEIEKLYTSYLSITFLRDFWGNPLRYDTEYYLIPVASSSKDV
QLKNITDYMYLTNAPSYTNGKLNIYYRRLYNGLKFIIKRYTPNNEIDSFVKSGDFIKLYV
SYNNNEHIVGYPKDGNAFNNLDRILRVGYNAPGIPLYKKMEAVKLRDLKTYSVQLKLYDD
KNASLGLVGTHNGQIGNDPNRDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND
Download sequence
Identical sequences P04958
gi|28373188|ref|NP_783831.1|NC_004565 212717.pE88_60 gi|28373188|ref|NP_783831.1| WP_011100836.1.27827 WP_011100836.1.49058 WP_011100836.1.83101 WP_011100836.1.96257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]