SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28210167|ref|NP_781111.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210167|ref|NP_781111.1|
Domain Number 1 Region: 18-136
Classification Level Classification E-value
Superfamily PH domain-like 9.22e-47
Family BPHL domain 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|28210167|ref|NP_781111.1|
Sequence length 137
Comment hypothetical protein CTC00414 [Clostridium tetani E88]
Sequence
MLMKLKNKGDINMGIFDGLMGNASEVNSEQVKKEYAHILAPNEKIEKSYKLIRDMFIFTN
KRLILVDKQGVTGKKTEYHSIPYRAITHFSIETVGHFDLDAELKIWISGSSTPVEKQFNK
SLNIYELQSVLAEYVLG
Download sequence
Identical sequences Q898N1
gi|28210167|ref|NP_781111.1| 212717.CTC00414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]