SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28210673|ref|NP_781617.1| from Clostridium tetani E88

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28210673|ref|NP_781617.1|
Domain Number 1 Region: 214-575
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.06e-85
Family Cellulases catalytic domain 0.024
Further Details:      
 
Domain Number 2 Region: 41-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.61e-38
Family Thioltransferase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|28210673|ref|NP_781617.1|
Sequence length 713
Comment thymidylate kinase [Clostridium tetani E88]
Sequence
MRNIFNLLVLAAFKIYSIFFILGYNNIKQLIKGSDSMTNSNRVPNRLAQEKSPYLLQHAY
NPVDWYPWGEEAFQKAKEEDKPIFLSIGYSTCHWCHVMERESFEDEEVAKVLNDNFISIK
VDREERPDIDNIYMTFCQAVTGSGGWPLTIIMTPDKKPFFAGTYFPKEDRYGVRGLMYIL
KEMSNQWKNNRELILNSSEKLLKDMSQYISVSQREDLNKEVIKECFEVLKESYDPIHGGF
YDAPKFPTSHKLMFLLRYYRLYKDEEALNIVEKTLKSMYKGGIFDHIGYGFSRYSTDDKW
LVPHFEKMLYDNAMLTIAYAEMYQITKEELYKEIIEKTISYVIRDMKDKKGAFYSAEDAD
SEGVEGKFYVWTLEEIEDILGKEDAKLFSKYYGITDRGNFEGENIPNLIETPLEDLEPDV
KDKLENIRKTLFINREKRIHPHKDTKILTSWNGLMIAALAYSGRVLKRKDYIESAEEAVK
FIMKNLIDENGRIYVRYRDGERAHKGHLEDYSFLIWALIELYQSTFKTEYIEKALKINYD
MIELFWDEENHGFFHTGKDGEELILKLKESYDSAIPSGNSVAMYNMVRLSRITGDSKLDE
IIQQNLNYFSGRIKSTLESHTFFLISYMHYVLESEEIVIVKGEDEDIFKAMIKVINEKYH
PFSMNIVKDEKVEKLMPELKEKNNIQNKTTVYICKNFACGNPIISLEDLIDKY
Download sequence
Identical sequences Q896N6
gi|28210673|ref|NP_781617.1| WP_011099216.1.12609 WP_011099216.1.27827 WP_011099216.1.49058 WP_011099216.1.71400 WP_011099216.1.81004 WP_011099216.1.83101 WP_011099216.1.84243 WP_011099216.1.96257 212717.CTC00965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]