SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72161330|ref|YP_288987.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72161330|ref|YP_288987.1|
Domain Number 1 Region: 5-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.83e-86
Family Cgl1923-like 0.00000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72161330|ref|YP_288987.1|
Sequence length 313
Comment hypothetical protein Tfu_0926 [Thermobifida fusca YX]
Sequence
MRDPADLYELRSDLPELSEPVMLVSLDGFVDAGAAGKQAVATLLDGLQHTELATFDIDGL
LDYRSRRPVMIFNETTWVSYAEPKLSLTLLHDLEGTPFLLLHGLEPDRRWEGFTAAVRQL
VERLSVRLTVCFYGIPMAVPHTRPVTATPHATRPELVTEHTPWVGRIQVPGNIMSLLEYR
LGQAGHDVIGYAVHVPSYLAQSEYPRAGLAVLEYIARVTGLVLPTEKLAEEATRVDGEIN
RQVEASEEVQRVVRNLEAQYDNFMAVHNGLDVDALLAGDESRLPTADELGAELERFLAEH
GRGSAEHDRGSEG
Download sequence
Identical sequences Q47RF3
gi|72161330|ref|YP_288987.1| WP_011291373.1.46431 WP_011291373.1.72373 WP_011291373.1.82272 269800.Tfu_0926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]