SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72162013|ref|YP_289670.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162013|ref|YP_289670.1|
Domain Number 1 Region: 52-456
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 2.75e-88
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000178
Further Details:      
 
Domain Number 2 Region: 555-868
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.31e-42
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|72162013|ref|YP_289670.1|
Sequence length 925
Comment cellulose-binding family II protein [Thermobifida fusca YX]
Sequence
MTATAQRTPPPPTPRRRGIIARALTCIAAAATVAAVGLVHSAAAPASATTGYTWRNVEIV
GGGFVPGIVFNQSEPDLIYARTDIGGAYRWDPATERWIPLLDHVGWDDWGHSGVVSIATD
PVDPDRVYAAVGTYTNDWDPNNGAIKRSTDRGETWETTELPFKLGGNMPGRGMGERLAID
PNDNSVLYLGAPSGHGLWKSTDYGKTWQKVTSFPNPGNYVADPSDVGGYLGDNQGVVWVV
FDPTSSSPGHVTKDIYVGVADKQNTVYRSTDGGQTWERIPGQPTGFLAQKGVFDHVNGLL
YIATSDTGGPYDGSDGEVWRYDTTTGTWTDITPADPDGFEYGFSGLTIDRQNPDTIMVVS
QILWWPDIQIWRSTDRGETWSRIWEFSGYPDRTLRYNHDISAAPWLDFNRQDNPPEVSPK
LGWMTQAFEIDPFNSDRMLYGTGATIYGSDNLTNWDEGKKIDIKVRAQGIEETAVQDLIA
PPGDTELVSALGDIGGFVHDDITVVPDAMFDSPFHGNTRSIDFAELNPSVMARVGEAVDG
EVDSHIGISTSGGSHWWAGQEPSGVTGAGTVAVNADGSRIVWSPDGTGVHYSTTLGSSWT
PSQGVPAGARVEADRVNPDKFYAFANGTFYTSTDGGATFTKSSAAGLPTKGNIRFAAVPG
HEGDIWLAGGETNSTYGMWRSTDSGATFTRITAVDEGDVVGFGKPAPGRSYPAVYTSSKI
NGVRGIFRSDDAGTTWVRINDDQHQWAWTGAAITGDPDVYGRVYIGTNGRGVIVGDLDGP
PPQPTEEPTEEPSTPPTEEPTEEPTEEPSTPPTEEPPGDAACAVSYQVLNEWGGGFQGEV
TITNTGDTPINGWELTWTFPDNQQITQAWNTQLTQSGAKVTARDAGWNSTIAPGGTASFG
FLGSPAPGSKPTEFTLNGTPCSAAG
Download sequence
Identical sequences Q47PH2
WP_011292038.1.46431 WP_011292038.1.72373 WP_011292038.1.82272 gi|72162013|ref|YP_289670.1| 269800.Tfu_1612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]