SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|72162225|ref|YP_289882.1| from Thermobifida fusca YX

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|72162225|ref|YP_289882.1|
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Cgl1923-like 3.14e-86
Family Cgl1923-like 0.0000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|72162225|ref|YP_289882.1|
Sequence length 281
Comment hypothetical protein Tfu_1826 [Thermobifida fusca YX]
Sequence
MPELDSVSELVEPVMVAAFEGWNDAGEAASAVIDHLTDVWGATELVSLDSEEYYDFQVTR
PQVTAVNGAHQGIHWPGVKVLLTRSPEGRDVVLVRGDEPSMRWRGFASDLLSIARELGVR
RVVLLGALLADVPHTRPVPVTGMFSHPELATSASLEPATYEGPTGIVGVLHDIFSAAGLE
TISLWAAVPHYVSQPPSPKATLALVRRVEDTLDLTVRLGELPENARAWERGVDELAAQDT
DIADYVRSLEEAKDAAELPEASGEAIAREFERYLRRRRGGS
Download sequence
Identical sequences Q47NW0
gi|72162225|ref|YP_289882.1| 269800.Tfu_1826 WP_011292250.1.46431 WP_011292250.1.82272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]